Anti-Ataxin-1, 11NQ Antibody FL594 Conjugate (N76/8)
Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Human, Mouse, Rat
ICC, IHC
Mouse
![KO Validated](https://cdn.shopify.com/s/files/1/0512/5793/4009/files/icon-ko-validated_430x.png)
SKU: 75-117-FL594
Product Details
Ataxin-1, 11NQ
Ataxin1, also known as spinocerebellar ataxia type 1 protein homolog, is a highly conserved DNA-binding protein. Ataxin1 is expressed in brain and can be found at high levels in the cortex and the hypothalamus in neurons. It is also expressed in other tissues. Within the cell, it is highly expressed in the nucleus, and can also be found in the cytoplasm. Mutations in the ataxin-1 gene cause spinocerebellar ataxia type 1.
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
N76/8
IgG2b
ICC, IHC
Mouse
Atxn1 Sca1
85 kDa
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
Human, Mouse, Rat
AB_2939438
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL594 Ex: 594 nm, Em: 615 nm
No cross-reactivity reported
Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Shipped on ice packs
Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)
UniProt (Human): P54254
UniProt (Immunogen Species): P54254
UniProt (Immunogen Species): P54254