Anti-SUR1 Antibody FL650 Conjugate (N289/16)
Our Anti-SUR1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N289/16. It is KO validated, detects hamster, mouse, rat SUR1, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Hamster, Mouse, Rat
ICC, IHC
Mouse
![KO Validated](https://cdn.shopify.com/s/files/1/0512/5793/4009/files/icon-ko-validated_430x.png)
SKU: 75-267-FL650
Product Details
SUR1
Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KCNJ11). SUR1 is involved in insulin release. SUR1 has broad expression in many tissues including brain, heart, pancreas (beta cells). Diseases associated with this gene include Familial Hyperinsulinemic Hypoglycemia and Diabetes Mellitus.
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
N289/16
IgG1
ICC, IHC
Mouse
Abcc8 Sur Sur1
180 kDa
Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (accession number Q09429) produced recombinantly in E. Coli
Hamster, Mouse, Rat
AB_2939963
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL650 Ex: 655 nm, Em: 676 nm
Does not cross-react with SUR2B (based on KO validation results)
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Shipped on ice packs
ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)
UniProt (Human): Q09428
UniProt (Immunogen Species): Q09429
UniProt (Immunogen Species): Q09429