Anti-BAF53b Antibody FL594 Conjugate (N332B/15)
Our Anti-BAF53b mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
Human, Mouse
ICC, IHC
Mouse

SKU: 75-311-FL594
Ships: 1-5 business days
Product Details
BAF53b
Actin Like 6B, of BAFcomplex 53 KDa Subunit (BAF53b) is encoded by the gene ACTL6B and is a member of actin-related proteins family. It is a subunit of the neuron specific chromatin remodeling complex (nBAF complex). ACTL6B plays a role in remodeling mononucleosomes in an ATP-dependent fashion, and is required for postmitotic neural development and dendritic outgrowth. Diseases associated with ACTL6B include Early Infantile Epileptic Encephalopathy 76 and Intellectual Developmental Disorder with Severe Speech and Ambulation Defects.
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
N332B/15
IgG1
ICC, IHC
Mouse
ACTL6B ACTL6 BAF53B
53 kDa
Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
Human, Mouse
AB_2940086
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL594 Ex: 594 nm, Em: 615 nm
Does not cross-react with BAF53a
Each new lot of antibody is quality control tested by IHC on either rat or mouse brain and confirmed to give the expected staining pattern.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Shipped on ice packs
Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)