Recombinant Mouse TNF alpha

Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication. Mouse TNF alpha Recombinant Protein is purified TNF alpha (TNFSF2) produced in yeast.



SKU: 6498

Volume: 5 µg
Price:
Sale price$200.00
Ships: 1-2 business days
Tumor necrosis factor alpha (TNFSF2, TNF alpha) is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication.
-20°C
Ships at ambient temperature, Domestic: Overnight Delivery; International: Priority Shipping
Lyophilized
LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)
Yeast
Recombinant proteins produced in yeast
United States
The Mouse TNF alpha protein can be used in cell culture, as a TNF alpha ELISA Standard, and as a Western Blot Control.

Bulk Order Recombinant Mouse TNF alpha

Related Products

Recently Viewed