Anti-Kir6.2 Potassium Channel Antibody FL550 Conjugate (N363/71)
Our Anti-Kir6.2 potassium channel mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N363/71. It detects mouse and rat Kir6.2 potassium channel, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
SKU: 75-393-FL550
Product Details
Kir6.2 potassium channel
ATP-sensitive inward rectifier potassium channel 11 or Kir6.2 is encoded by the gene KCNJ11. Kir6.2 is an integral membrane protein which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins. Kir6.2 has broad expression in many tissues including brain, heart, pancreas (beta cells) and thyroid. Diseases associated with this gene include several forms of diabetes.
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
N363/71
IgG1
ICC, IHC
Mouse
Kcnj11
45 kDa
Fusion protein amino acids 345-390 (TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS, cytoplasmic C-terminus) of rat Kir6.2 (accession number P70673) produced recombinantly in E. Coli
Mouse, Rat
AB_2940293
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL550 Ex: 550 nm, Em: 575 nm
Does not cross-react with Kir6.1
Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Shipped on ice packs
ATP-sensitive inward rectifier potassium channel 11 (BIR) (Inward rectifier K(+) channel Kir6.2) (Potassium channel, inwardly rectifying subfamily J member 11)
UniProt (Human): Q14654
UniProt (Immunogen Species): P70673
UniProt (Immunogen Species): P70673