Anti-REEP1 Antibody FL650 Conjugate (N345/51)
Our Anti-REEP1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
SKU: 75-313-FL650
Product Details
REEP1
Receptor expression-enhancing protein 1, Receptor Accessory Protein 1 or REEP1 is encoded by the gene REEP1. The REEP protein family is made up of six REEP proteins 1-6. REEP1 is a mitochondrial protein that links ER tubules to the cytoskeleton and is involved in ER formation and remodeling. REEP1 is expressed in brain, spinal cord and testes. It is also expressed in olfactory sensory neurons and may play a role in the cell surface expression of odorant receptors. Diseases associated with this gene include Spastic Paraplegia distal hereditary motor neuropathy type V. Ref: Brain Res. 2014 January 30; 1545: 12–22. doi:10.1016/j.brainres.2013.12.008
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
N345/51
IgG2b
ICC, IHC
Mouse
Reep1 D6Ertd253e C2orf23 SPG31
22 kDa
Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
Mouse, Rat
AB_2940095
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL650 Ex: 655 nm, Em: 676 nm
Does not cross-react with REEP2
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Shipped on ice packs
Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
UniProt (Human): Q9H902
UniProt (Immunogen Species): Q8BGH4
UniProt (Immunogen Species): Q8BGH4