Anti-SUR1 and SUR2B Antibody FL490 Conjugate (N323A/31)
Our Anti-SUR1 and SUR2B mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N323A/31. It detects mouse and rat SUR1 and SUR2B, and is purified by Protein A chromatography. It is great for use in IHC, ICC.
SKU: 75-298-FL490
Product Details
SUR1 and SUR2B
SUR1 and SUR2B are members of the ATP binding cassette transporter subfamily C. These proteins combine with KCNJ8(Kir6.1) or KCNJ11(Kir6.2) to form K+ATP channels and are involved in their regulation and activation.
Purified by Protein A chromatography
0.5 mg/mL
Monoclonal
N323A/31
IgG1
ICC, IHC
Mouse
Abcc8 Sur Sur1 Abcc9 Sur2
175 kDa (and smaller fragments likely due to proteolytic cleavage)
Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
Mouse, Rat
AB_2940044
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.
PBS with 0.09% azide
FL490 Ex: 491 nm, Em: 515 nm
Cross-reacts with SUR1
Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
12 months from date of receipt
Shipped on ice packs
ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1) ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)
UniProt (Human): Q09428
UniProt (Immunogen Species): Q63563-2
UniProt (Immunogen Species): Q63563-2