Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N76/3. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by Protein A chromatography. It is great for use in IHC, ICC, IP, WB.
Ataxin1, also known as spinocerebellar ataxia type 1 protein homolog, is a highly conserved DNA-binding protein. Ataxin1 is expressed in brain and can be found at high levels in the cortex and the hypothalamus in neurons. It is also expressed in other tissues. Within the cell, it is highly expressed in the nucleus, and can also be found in the cytoplasm. Mutations in the ataxin-1 gene cause spinocerebellar ataxia type 1.
Purified by Protein A chromatography
1 mg/mL
Monoclonal
N76/3
IgG1
ICC, IHC, IP, WB
Mouse
Atxn1 Sca1
85 kDa
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)
Drosophila, Human, Mouse, Rat
AB_2061163
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.49
WB: 1:1000
IHC: 1:1000
IP: 1:50
Unconjugated
No cross-reactivity reported
Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
24 months from date of receipt
Shipped on ice packs
Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)
Hu, Y.S., et al. 2019. Self-assembling vascular endothelial growth factor nanoparticles improve function in spinocerebellar ataxia type 1. Brain, 312-321.
Sousa, A., et al. 2023. On the Identification of Potential Novel Therapeutic Targets for Spinocerebellar Ataxia Type 1 (SCA1) Neurodegenerative Disease Using EvoPPI3. Journal of Integrative Bioinformatics, .
Bergeron, D., et al. 2013. An out-of-frame overlapping reading frame in the ataxin-1 coding sequence encodes a novel ataxin-1 interacting protein.. The Journal of Biological Chemistry, 21824-21835.
Edamakanti, C.R., et al. 2018. Mutant ataxin1 disrupts cerebellar development in spinocerebellar ataxia type 1.. The Journal of clinical investigation, 2252-2265.
Venkatraman, A., et al. 2014. The histone deacetylase HDAC3 is essential for Purkinje cell function, potentially complicating the use of HDAC inhibitors in SCA1.. Human Molecular Genetics, 3733-3745.
Zhang, C., et al. 2010. Loss of function of ATXN1 increases amyloid beta-protein levels by potentiating beta-secretase processing of beta-amyloid precursor protein.. The Journal of Biological Chemistry, 8515-8526.
Bulk Order Anti-Ataxin-1, 11NQ Antibody
Related Products
Recently Viewed
Your research is our top priority
Highly-validated antibodies and reagents from our family of brands.