Anti-BAF53b Antibody (N332B/15)

10 Citations

Our Anti-BAF53b mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.

Adult rat hippocampus immunohistochemistry.
Adult rat hippocampus immunohistochemistry.
Roll over image to zoom in Click on image to zoom
Adult rat hippocampus immunohistochemistry.
Immunoblot versus samples from adult rat brain (RBLSP) and WT and BAF53b KO mouse brains probed with N332B/15 (left) and N336B/83 (right) TC supes. Mouse samples courtesy of Ann Kuo and Gerald Crabtree (Stanford).
Tissue and transfected cell immunoblot: extracts of rat brain low speed pellet (RBLSP) and COS cells transiently transfected with untagged BAF53a, BAF53b or Kv2.1 plasmids and probed with N332B/15 (left) and N52A/42 (right) TC supe.

Human, Mouse
ICC, IHC, WB
Mouse
490
550
594
650
Carrier-Free

Go to Full Product Details

Data Sheet
KO Validated KO Validated

SKU: 75-311

Volume: 100 µL
Price:
$329.00
Ships: 1-2 business days

Product Details

BAF53b
Actin Like 6B, of BAFcomplex 53 KDa Subunit (BAF53b) is encoded by the gene ACTL6B and is a member of actin-related proteins family. It is a subunit of the neuron specific chromatin remodeling complex (nBAF complex). ACTL6B plays a role in remodeling mononucleosomes in an ATP-dependent fashion, and is required for postmitotic neural development and dendritic outgrowth. Diseases associated with ACTL6B include Early Infantile Epileptic Encephalopathy 76 and Intellectual Developmental Disorder with Severe Speech and Ambulation Defects.
Purified by Protein A chromatography
1 mg/mL
Monoclonal
N332B/15
IgG1
ICC, IHC, WB
Mouse
ACTL6B ACTL6 BAF53B
53 kDa
Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli
Human, Mouse
AB_2315811
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
WB: 1:1000
IHC: 1:500
ICC: 1:500
Unconjugated
Does not cross-react with BAF53a
Each new lot of antibody is quality control tested by IHC on either rat or mouse brain and confirmed to give the expected staining pattern.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
24 months from date of receipt
Shipped on ice packs
Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)
O94805

Product Specific References for Applications and Species

Immunocytochemistry: Mouse
PMID Dilution Publication
29974865not listedLee, S.W., et al. 2018. MicroRNAs Overcome Cell Fate Barrier by Reducing EZH2-Controlled REST Stability during Neuronal Conversion of Human Adult Fibroblasts. Developmental Cell, 73-84.
Immunohistochemistry: Mouse
PMID Dilution Publication
284166311:500Vogel Ciernia, A, et al. 2017. Mutation of neuron-specific chromatin remodeling subunit BAF53b: rescue of plasticity and memory by manipulating actin remodeling.. Learning and Memory, 199-209.
28270570not listedYoo, M., et al. 2017. BAF53b, a Neuron-Specific Nucleosome Remodeling Factor, Is Induced after Learning and Facilitates Long-Term Memory Consolidation. Journal of Neuroscience, 3686-3697.
Western Blot: Mouse
PMID Dilution Publication
32817243not listedYoo, M., et al. 2020. Persistence of Fear Memory Depends on a Delayed Elevation of BAF53b and FGF1 Expression in the Lateral Amygdala. Journal of Neuroscience, 7133-7141.
309954821:6 (supe)Nakano, Y., et al. 2019. Overlapping Activities of Two Neuronal Splicing Factors Switch the GABA Effect from Excitatory to Inhibitory by Regulating REST. Cell Reports, 860-871.
29974865not listedLee, S.W., et al. 2018. MicroRNAs Overcome Cell Fate Barrier by Reducing EZH2-Controlled REST Stability during Neuronal Conversion of Human Adult Fibroblasts. Developmental Cell, 73-84.
284166311:500Vogel Ciernia, A, et al. 2017. Mutation of neuron-specific chromatin remodeling subunit BAF53b: rescue of plasticity and memory by manipulating actin remodeling.. Learning and Memory, 199-209.
272263551:1000White, A.O., et al. 2016. BDNF rescues BAF53b-dependent synaptic plasticity and cocaine-associated memory in the nucleus accumbens. Nature Communications, 11725.
Western Blot: Rat
PMID Dilution Publication
39412992not listedCornejo, KG, et al. 2024. Activity-assembled nBAF complex mediates rapid immediate early gene transcription by regulating RNA polymerase II productive elongation. Cell Reports, 114877.
Additional Publications: Unspecified
PMID Publication
38066314Lee, SW, et al. 2023. Longitudinal modeling of human neuronal aging reveals the contribution of the RCAN1-TFEB pathway to Huntington's disease neurodegeneration. Nature Aging, 95-109.

Bulk Order Anti-BAF53b Antibody

Related Products

Recently Viewed