Recombinant Mouse IL-10

IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.



SKU: 6503

Volume: 5 µg
Price:
Sale price$194.00
IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which consists of nine members: IL-10, IL-19, IL-20, IL-22, IL-24, IL-26, IL-28A, IL-28B, and IL-29. These cytokines elicit diverse host defense mechanisms. IL-10 family cytokines have indispensable functions in many infectious and inflammatory diseases. IL-10 family cytokines are essential for maintaining the integrity and homeostasis of tissue epithelial layers. By promoting innate immune response, members of this family can limit the damage caused by viral and bacterial infections. They can also facilitate the tissue-healing process in injuries caused by infection or inflammation.
-20°C
Ships at ambient temperature, Domestic: Overnight Delivery; International: Priority Shipping
Lyophilized
SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)
Yeast
Recombinant proteins produced in yeast
United States
The Mouse IL-10 protein can be used in cell culture, as an IL-10 ELISA Standard, and as a Western Blot Control.

Related Products

Recently Viewed