Anti-SUR1 Antibody (N289/16)

8 Citations

Our Anti-SUR1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N289/16. It is KO validated, detects hamster, mouse, rat SUR1, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.

Immunofluorescence against SUR1 WT (left) and null mutant (right) mouse striatum and stained with N289/16 (green) and commercial antibody against Tyrosine Hydroxylase (blue). Images courtesy of Paul Witkovsky, Jyoti Patel and Margaret Rice, New York University Medical Center.
Immunofluorescence against SUR1 WT (left) and null mutant (right) mouse striatum and stained with N289/16 (green) and commercial antibody against Tyrosine Hydroxylase (blue). Images courtesy of Paul Witkovsky, Jyoti Patel and Margaret Rice, New York University Medical Center.
Roll over image to zoom in Click on image to zoom
Immunofluorescence against SUR1 WT (left) and null mutant (right) mouse striatum and stained with N289/16 (green) and commercial antibody against Tyrosine Hydroxylase (blue). Images courtesy of Paul Witkovsky, Jyoti Patel and Margaret Rice, New York University Medical Center.
Adult rat hippocampus immunohistochemistry (with antigen retrieval via Na citrate pretreatment).
Immunoblot versus crude brain membrane preparations from rat (RBM), SUR1 wild-type (WT) and knockout (KO) mice and probed with N289/16 (left), N52A/42 (center) and K89/34 (right) TC supe. Mouse brains courtesy of William Coetzee and Margaret Rice, New York University Medical Center.

Hamster, Mouse, Rat
ICC, IHC, WB
Mouse
490
550
594
650
Carrier-Free

Go to Full Product Details

Data Sheet
KO Validated KO Validated

SKU: 75-267

Volume: 100 µL
Price:
$329.00
Ships: 1-2 business days

Product Details

SUR1
Sulfonylurea receptor 1 (SUR1), or ATP binding cassette transporter subfamily C member 8 is encoded by the gene ABCC8 and is a member of the ABC transporter super family. SUR1 acts to modulate ATP sensitive potassium channels and combines with Kir6.2 (KCNJ11). SUR1 is involved in insulin release. SUR1 has broad expression in many tissues including brain, heart, pancreas (beta cells). Diseases associated with this gene include Familial Hyperinsulinemic Hypoglycemia and Diabetes Mellitus.
Purified by Protein A chromatography
1 mg/mL
Monoclonal
N289/16
IgG1
ICC, IHC, WB
Mouse
Abcc8 Sur Sur1
180 kDa
Fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1 (accession number Q09429) produced recombinantly in E. Coli
Hamster, Mouse, Rat
AB_11001558
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Unconjugated
Does not cross-react with SUR2B (based on KO validation results)
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
24 months from date of receipt
Shipped on ice packs
ATP-binding cassette sub-family C member 8 (Sulfonylurea receptor 1)
Q09429

Product Specific References for Applications and Species

Immunocytochemistry: Human
PMID Dilution Publication
243920211:500Karnik, R., et al. 2013. Endocytosis of HERG is clathrin-independent and involves arf6.. PLoS One, e85630.
Immunohistochemistry: Mouse
PMID Dilution Publication
299601151:200Ruan, J.S., et al. 2018. Chronic palmitic acid-induced lipotoxicity correlates with defective trafficking of ATP sensitive potassium channels in pancreatic β cells. Journal of Nutritional Biochemistry, 37-48.
238584701:200Park, S.H., et al. 2013. Leptin promotes K(ATP) channel trafficking by AMPK signaling in pancreatic β-cells.. PNAS USA, 12673-12678.
Western Blot: Hamster
PMID Dilution Publication
23798684not listedLi, J.B., et al. 2013. Decomposition of slide helix contributions to ATP-dependent inhibition of Kir6.2 channels.. Journal of Biological Chemistry, 23038-23049.
Western Blot: Human
PMID Dilution Publication
25720052not listedHarel, S., et al. 2015. Alternating hypoglycemia and hyperglycemia in a toddler with a homozygous p.R1419H ABCC8 mutation: an unusual clinical picture.. Journal of Pediatric Endocrinology and Metabolism, 345-351.
24257076not listedBruin, J.E., et al. 2014. Characterization of polyhormonal insulin-producing cells derived in vitro from human embryonic stem cells.. Stem Cell Research, 194-208.
Western Blot: Mouse
PMID Dilution Publication
335291731:250Zhang, H., et al. 2021. Complex consequences of Cantu syndrome SUR2 variant R1154Q in genetically modified mice. JCI Insight, e145934.
238584701:250Park, S.H., et al. 2013. Leptin promotes K(ATP) channel trafficking by AMPK signaling in pancreatic β-cells.. PNAS USA, 12673-12678.
Western Blot: Rat
PMID Dilution Publication
293207411:500Han, Y.E., et al. 2018. Endocytosis of KATP Channels Drives Glucose-Stimulated Excitation of Pancreatic β Cells. Cell Reports, 471-481.

Bulk Order Anti-SUR1 Antibody

Related Products

Recently Viewed