Anti-SVOP Antibody (N356/23)
Our Anti-SVOP mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by Protein A chromatography. It is great for use in ICC, WB.
SKU: 75-353
Product Details
SVOP
Synaptic vesicle 2-related protein or SVOP is encoded by the gene SVOP. SVOP contains 12 transmembrane regions and has transporter and ion transmembrane transporter activity. SVOP is expressed early in development and expressed in brain and endocrine cells where it is found in synaptic vesicles and microvesicles. Diseases associated with SVOP include Intestinal Botulism and Familial Atrial Fibrillation.
Purified by Protein A chromatography
1 mg/mL
Monoclonal
N356/23
IgG1
ICC, WB
Mouse
Svop
60 kDa
Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (accession number Q9Z2I7) produced recombinantly in E. Coli
Mouse, Rat
AB_2315934
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Unconjugated
Does not cross-react with SVOPL/SVOP2
Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
24 months from date of receipt
Shipped on ice packs
Synaptic vesicle 2-related protein (SV2-related protein)
UniProt (Human): Q8N4V2
UniProt (Immunogen Species): Q9Z2I7
UniProt (Immunogen Species): Q9Z2I7