Anti-SUR2B Antibody (N323B/20)
Our Anti-SUR2B mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N323B/20. It detects human, mouse, and rat SUR2B, and is TC supernatant. It is great for use in IHC, ICC, WB.
SKU: 73-399
Product Details
SUR2B
Sulfonylurea receptor 2B (SUR2A), or ATP binding cassette transporter subfamily C member 9 is encoded by the gene ABCC9 and is a member of the ABC transporter super family. Differential splicing of the ABCC9 gene produces 2 isoforms, SUR2A and SUR2B. SUR2b forms smooth muscle KATP channels with KCNJ8(Kir6.1) and is is involved in regulation and activation. It is also expressed in brain. Diseases associated with this gene include Cantu Syndrome and Dilated Cardiomyopathy 1O.
TC Supernatant
Lot dependent
Monoclonal
N323B/20
IgG2b
ICC, IHC, WB
Mouse
Abcc9 Sur2
175 kDa (and smaller fragments likely due to proteolytic cleavage)
Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B (accession number Q63563-2) produced recombinantly in E. Coli
Human, Mouse, Rat
AB_2341102
Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Liquid
Supernatant is harvested from hybridoma cells grown under standard cell culture conditions
Supernatant is provided in cell culture medium with 0.1% sodium azide as anti-microbial
Unconjugated
Does not cross-react with SUR1
Each new lot of antibody is quality control tested on cells overexpressing target protein and confirmed to give the expected staining pattern.
These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
United States
24 months from date of receipt
Shipped on ice packs
ATP-binding cassette sub-family C member 9 (Sulfonylurea receptor 2)